PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009337
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 304aa    MW: 33508.3 Da    PI: 6.3835
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009337genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-42121121101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp eqp+kfa vh++FGasn+ k+l++lp ++reda++sl+yeA+ar+rdPvyG+vg i++lqq+l++l+ +l++++
  Lus10009337  12 PCAACKFLRRKCTSECVFAPYFPPEQPSKFATVHRVFGASNIAKILNELPASDREDAVTSLFYEADARLRDPVYGCVGYISHLQQRLKELHFNLESAR 109
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  ++l
  Lus10009337 110 HQL 112
                  985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.25611112IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-4212109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAMAPPVSHN SPCAACKFLR RKCTSECVFA PYFPPEQPSK FATVHRVFGA SNIAKILNEL  60
PASDREDAVT SLFYEADARL RDPVYGCVGY ISHLQQRLKE LHFNLESARH QLSCYVSPPP  120
PQIPPNFNPN PTPFPLQMMS VPTGSGVPSG QIINNNNLQQ QQPQQQQQQF HNLMEVQQQQ  180
MGPGSSTAQQ QEMIMRAYDQ QLQQLQQGGI YRGADGSVTL AGYNQIGNHQ HHHQQHHHMG  240
VSPISLEIGR DVHDGSSTVA APAVGEINGD DGGRFQLFLQ QPQQEGAEDE EETGRSRSNI  300
IGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079178.12e-59PREDICTED: LOB domain-containing protein 36-like
RefseqXP_012079177.12e-59PREDICTED: LOB domain-containing protein 36-like
TrEMBLA0A067K7022e-59A0A067K702_JATCU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-55ASYMMETRIC LEAVES 2-like 1